PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10016498m
Common NameCICLE_v10016498mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family NF-YB
Protein Properties Length: 238aa    MW: 26426.4 Da    PI: 7.2533
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10016498mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB177.11.7e-5556152197
            NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94 
                      vreqdrf+Pianv+rim+k+lP++akis+daket+qecvse+isf+t+ea+++cqre+rkti+++d+lwa+++lGf+dy+epl+vyl++yre+e
  Ciclev10016498m  56 VREQDRFMPIANVIRIMRKILPQHAKISDDAKETIQECVSEYISFITGEANERCQREQRKTITAEDVLWAMSKLGFDDYIEPLTVYLHRYREME 149
                      69******************************************************************************************** PP

            NF-YB  95 gek 97 
                      ge+
  Ciclev10016498m 150 GER 152
                      *97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.4E-5151158IPR009072Histone-fold
SuperFamilySSF471136.83E-3959159IPR009072Histone-fold
PfamPF008085.2E-2662126IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.1E-1690108No hitNo description
PROSITE patternPS00685093109IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.1E-16109127No hitNo description
PRINTSPR006151.1E-16128146No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0033613Molecular Functionactivating transcription factor binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 238 aa     Download sequence    Send to blast
MERTGGFRGY RQQLPNASRG PGLKFTETNI RLASAHEINQ TNNNNHTNYE DNECTVREQD  60
RFMPIANVIR IMRKILPQHA KISDDAKETI QECVSEYISF ITGEANERCQ REQRKTITAE  120
DVLWAMSKLG FDDYIEPLTV YLHRYREMEG ERGSIRGEPP LVKRPPVEFR TLGVAAFAAP  180
AAAFHHMGLG RGHGFLGAAT APATGTYFNN NDPSNNNTAA GSSQPAVANG ETYAHNK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A3e-4055147193NF-YB
4awl_B2e-4055147294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A2e-4055147294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF2941640.0KF294164.1 Citrus sinensis cultivar Valencia leafy cotyledon 1-like protein (L1L) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006449931.11e-179hypothetical protein CICLE_v10016498mg
SwissprotQ84W662e-72NFYB6_ARATH; Nuclear transcription factor Y subunit B-6
TrEMBLV4ULH11e-179V4ULH1_9R
STRINGVIT_00s0956g00020.t011e-89(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM98962636
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.18e-70nuclear factor Y, subunit B6